
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ETV7 Antibody
상품 한눈에 보기
Human ETV7 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 재조합 발현 검증을 완료했습니다. TEL-2(TEL2)로도 알려진 ETV7 연구에 유용합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029033-100 Anti-ETV7 Antibody, ets variant 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029033-25 Anti-ETV7 Antibody, ets variant 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ETV7 Antibody
Anti-ETV7 Antibody
Target: ets variant 7 (ETV7)
Type: Polyclonal Antibody against Human ETV7
Supplier: Atlas Antibodies
Recommended Applications
- WB (Recombinant Expression Validation): Validation in Western Blot using target protein overexpression
- ICC: Immunocytochemistry
Product Description
Polyclonal antibody raised in rabbit against Human ETV7 (ets variant 7).
Validated for recombinant expression in WB and ICC applications.
Alternative Gene Names
TEL-2, TEL2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ets variant 7 |
| Target Gene | ETV7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000030199 (33%), Rat ENSRNOG00000005984 (33%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



