CacheBy
Atlas Antibodies Anti-ERCC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ERCC4 Antibody

상품 한눈에 보기

Human ERCC4 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 추천됩니다. FANCQ, RAD1, XPF 등의 대체 유전자명을 가지며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대해 검증되었으며, PBS와 글리세롤 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045828-100 Anti-ERCC4 Antibody, excision repair cross-complementation group 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045828-25 Anti-ERCC4 Antibody, excision repair cross-complementation group 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERCC4 Antibody

Anti-ERCC4 Antibody

Target: excision repair cross-complementation group 4
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ERCC4.


Alternative Gene Names

  • FANCQ
  • RAD1
  • XPF

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein excision repair cross-complementation group 4
Target Gene ERCC4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000022545 (75%), Rat ENSRNOG00000053079 (74%)

Antigen Sequence:

SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.