CacheBy
Atlas Antibodies Anti-ERCC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ERCC5 Antibody

상품 한눈에 보기

인간 ERCC5 단백질을 인식하는 폴리클로날 항체로, excision repair cross-complementation group 5 단백질 검출에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 면역조직화학(IHC) 등 다양한 응용에 사용 가능합니다.

카탈로그번호
HPA050374-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050374-100 Anti-ERCC5 Antibody, ERCC excision repair 5, endonuclease 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050374-25 Anti-ERCC5 Antibody, ERCC excision repair 5, endonuclease 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ERCC5 Antibody

Anti-ERCC5 Antibody

Target: Excision repair cross-complementation group 5 (ERCC5)
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human ERCC5.

Alternative Gene Names

ERCM2, XPGC

Open Datasheet (PDF)

Target Information

  • Target Protein: Excision repair cross-complementation group 5
  • Target Gene: ERCC5

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000022812 (83%)
  • Mouse ENSMUSG00000026048 (83%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.