Atlas Antibodies Anti-EPOP Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA056555-100 | - | Atlas Antibodies HPA056555-100 Anti-EPOP Antibody, elongin BC and polycomb repressive complex 2 associated protein 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA056555-25 | - | Atlas Antibodies HPA056555-25 Anti-EPOP Antibody, elongin BC and polycomb repressive complex 2 associated protein 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-EPOP Antibody
elongin BC and polycomb repressive complex 2 associated protein
Recommended Applications
Product Description
Polyclonal Antibody against Human EPOP
Alternative Gene Names
C17orf96, LOC100170841, PRR28
Target Protein
elongin BC and polycomb repressive complex 2 associated protein
Target Gene
EPOP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
ETLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000048187 (92%)
Mouse ENSMUSG00000043439 (89%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|