Atlas Antibodies Anti-EPOP Antibody

상품 한눈에 보기

Human EPOP 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, elongin BC 및 polycomb repressive complex 2 관련 단백질 검출에 적합. 고순도의 Affinity purified 제품으로 다양한 종 간 교차반응성 검증 완료. 연구용으로 최적화된 항체.

카탈로그번호: HPA056555-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056555-100 Anti-EPOP Antibody, elongin BC and polycomb repressive complex 2 associated protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056555-25 Anti-EPOP Antibody, elongin BC and polycomb repressive complex 2 associated protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-EPOP Antibody

Anti-EPOP Antibody

Target: elongin BC and polycomb repressive complex 2 associated protein
Supplier: Atlas Antibodies

Recommended Applications

ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human EPOP

Alternative Gene Names

C17orf96
LOC100170841
PRR28

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	elongin BC and polycomb repressive complex 2 associated protein
Target Gene	EPOP
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	ETLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPL
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000048187 (92%), Mouse ENSMUSG00000043439 (89%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand