AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EPOP Antibody
상품 한눈에 보기
Human EPOP 단백질을 인식하는 Rabbit Polyclonal 항체로, elongin BC 및 polycomb repressive complex 2 관련 단백질 검출에 적합. 높은 종 간 보존성. Affinity purification 방식으로 정제되어 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055190-100 Anti-EPOP Antibody, elongin BC and polycomb repressive complex 2 associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055190-25 Anti-EPOP Antibody, elongin BC and polycomb repressive complex 2 associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EPOP Antibody
Anti-EPOP Antibody
elongin BC and polycomb repressive complex 2 associated protein
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human EPOP
Alternative Gene Names
- C17orf96
- LOC100170841
- PRR28
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | elongin BC and polycomb repressive complex 2 associated protein |
| Target Gene | EPOP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ETLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPL |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000048187 | 92% |
| Mouse | ENSMUSG00000043439 | 89% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.