CacheBy
Atlas Antibodies Anti-SLC6A19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC6A19 Antibody

상품 한눈에 보기

Human SLC6A19 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 분석에 적합합니다. RNA-seq 데이터 기반의 정교한 Orthogonal 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. PBS/glycerol 완충액 내 보존제로 sodium azide를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043207-100 Anti-SLC6A19 Antibody, solute carrier family 6 (neutral amino acid transporter), member 19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043207-25 Anti-SLC6A19 Antibody, solute carrier family 6 (neutral amino acid transporter), member 19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC6A19 Antibody

Anti-SLC6A19 Antibody

Target: solute carrier family 6 (neutral amino acid transporter), member 19

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SLC6A19.
Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 6 (neutral amino acid transporter), member 19
Target Gene SLC6A19
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGT
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000021565 (79%), Rat ENSRNOG00000026501 (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.