Atlas Antibodies Anti-SLC6A19 Antibody

상품 한눈에 보기

Human SLC6A19 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 분석에 적합합니다. RNA-seq 데이터 기반의 정교한 Orthogonal 검증을 거쳤으며, PrEST 항원을 이용해 친화 정제되었습니다. PBS/glycerol 완충액 내 보존제로 sodium azide를 포함합니다.

카탈로그번호: HPA043207-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043207-100 Anti-SLC6A19 Antibody, solute carrier family 6 (neutral amino acid transporter), member 19 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043207-25 Anti-SLC6A19 Antibody, solute carrier family 6 (neutral amino acid transporter), member 19 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC6A19 Antibody

Anti-SLC6A19 Antibody

Target: solute carrier family 6 (neutral amino acid transporter), member 19

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SLC6A19.
Open Datasheet

Target Information

항목	내용
Target Protein	solute carrier family 6 (neutral amino acid transporter), member 19
Target Gene	SLC6A19
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	GFRATQRYDDCFSTNILTLINGFDLPEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGT
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000021565 (79%), Rat ENSRNOG00000026501 (77%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet