CacheBy
Atlas Antibodies Anti-SLC6A4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC6A4 Antibody

상품 한눈에 보기

Human SLC6A4 단백질을 인식하는 Rabbit Polyclonal IgG 항체로, Affinity purification 방식으로 제조됨. 신경전달물질 수송체 연구에 적합하며, 높은 종간 반응성(인간, 마우스, 랫드)을 보임. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074728-100 Anti-SLC6A4 Antibody, solute carrier family 6 (neurotransmitter transporter), member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074728-25 Anti-SLC6A4 Antibody, solute carrier family 6 (neurotransmitter transporter), member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC6A4 Antibody

Anti-SLC6A4 Antibody

Target: Solute carrier family 6 (neurotransmitter transporter), member 4
Supplier: Atlas Antibodies

Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SLC6A4

Alternative Gene Names

  • 5-HTT
  • HTT
  • OCD1
  • SERT1

Open Datasheet (PDF)

Target Information

  • Target Protein: Solute carrier family 6 (neurotransmitter transporter), member 4
  • Target Gene: SLC6A4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000020838 (90%)
  • Rat ENSRNOG00000003476 (88%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.