Atlas Antibodies Anti-SLC4A1AP Antibody

상품 한눈에 보기

Human SLC4A1AP 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었고 Rat 및 Mouse와 높은 상동성을 가집니다.

카탈로그번호: HPA036679-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036679-100 Anti-SLC4A1AP Antibody, solute carrier family 4 (anion exchanger), member 1, adaptor protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036679-25 Anti-SLC4A1AP Antibody, solute carrier family 4 (anion exchanger), member 1, adaptor protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC4A1AP Antibody

Anti-SLC4A1AP Antibody

Target: solute carrier family 4 (anion exchanger), member 1, adaptor protein
Product Type: Polyclonal Antibody against Human SLC4A1AP

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human SLC4A1AP (solute carrier family 4 (anion exchanger), member 1, adaptor protein).

Alternative Gene Names

HLC3
kanadaptin

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	solute carrier family 4 (anion exchanger), member 1, adaptor protein
Target Gene	SLC4A1AP
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000004901 (97%)
Mouse ENSMUSG00000029141 (95%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand