Atlas Antibodies Anti-SLC4A10 Antibody

상품 한눈에 보기

인체 SLC4A10 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인할 수 있습니다. 고순도 Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA076725-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA076725-100 Anti-SLC4A10 Antibody, solute carrier family 4 member 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA076725-25 Anti-SLC4A10 Antibody, solute carrier family 4 member 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC4A10 Antibody

Anti-SLC4A10 Antibody

Target Protein: solute carrier family 4, sodium bicarbonate transporter, member 10
Target Gene: SLC4A10
Alternative Gene Names: NBCn2, NCBE

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC4A10

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000005307	91%
Mouse	ENSMUSG00000026904	89%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand