CacheBy
Atlas Antibodies Anti-SLC4A10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC4A10 Antibody

상품 한눈에 보기

인체 SLC4A10 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인할 수 있습니다. 고순도 Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA076725-100 Anti-SLC4A10 Antibody, solute carrier family 4 member 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076725-25 Anti-SLC4A10 Antibody, solute carrier family 4 member 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC4A10 Antibody

Anti-SLC4A10 Antibody

Target Protein: solute carrier family 4, sodium bicarbonate transporter, member 10
Target Gene: SLC4A10
Alternative Gene Names: NBCn2, NCBE

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC4A10

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLT

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000005307 91%
Mouse ENSMUSG00000026904 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.