CacheBy
Atlas Antibodies Anti-SLC39A5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC39A5 Antibody

상품 한눈에 보기

Human SLC39A5 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제됨. ICC 등 다양한 응용에 적합하며, PBS와 글리세롤 버퍼에 보존제 포함. 사람 대상 반응성 검증 완료.

카탈로그번호
HPA018423-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018423-100 Anti-SLC39A5 Antibody, solute carrier family 39 (zinc transporter), member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018423-25 Anti-SLC39A5 Antibody, solute carrier family 39 (zinc transporter), member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC39A5 Antibody

Anti-SLC39A5 Antibody

Target: solute carrier family 39 (zinc transporter), member 5
Type: Polyclonal Antibody against Human SLC39A5


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human SLC39A5 (solute carrier family 39, zinc transporter, member 5).

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 39 (zinc transporter), member 5
Target Gene SLC39A5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPR
Verified Species Reactivity Human
Interspecies Identity Mouse (84%), Rat (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.