CacheBy
Atlas Antibodies Anti-SLC39A3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC39A3 Antibody

상품 한눈에 보기

인간 SLC39A3(ZIP3) 단백질을 인식하는 폴리클로날 항체로, IHC, WB(재조합 발현 검증), ICC에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증된 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA058526-100 Anti-SLC39A3 Antibody, solute carrier family 39 (zinc transporter), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058526-25 Anti-SLC39A3 Antibody, solute carrier family 39 (zinc transporter), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC39A3 Antibody

Anti-SLC39A3 Antibody

solute carrier family 39 (zinc transporter), member 3


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SLC39A3


Alternative Gene Names

  • ZIP3

Open Datasheet


Target Information

항목 내용
Target Protein solute carrier family 39 (zinc transporter), member 3
Target Gene SLC39A3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000045524 (68%)
Mouse ENSMUSG00000046822 (68%)

Antigen Sequence:

TFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.