CacheBy
Atlas Antibodies Anti-SLC36A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC36A2 Antibody

상품 한눈에 보기

Human SLC36A2 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, Orthogonal validation으로 신뢰도 높은 결과를 제공합니다.

카탈로그번호
HPA062229-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062229-100 Anti-SLC36A2 Antibody, solute carrier family 36 (proton/amino acid symporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062229-25 Anti-SLC36A2 Antibody, solute carrier family 36 (proton/amino acid symporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC36A2 Antibody

Anti-SLC36A2 Antibody

Target: solute carrier family 36 (proton/amino acid symporter), member 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SLC36A2.


Alternative Gene Names

PAT2, TRAMD1, tramdorin

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein solute carrier family 36 (proton/amino acid symporter), member 2
Target Gene SLC36A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVF
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000011892 (53%), Mouse ENSMUSG00000020264 (53%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.