CacheBy
Atlas Antibodies Anti-SLC35F1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC35F1 Antibody

상품 한눈에 보기

Human SLC35F1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 검증되었으며, RNA-seq 데이터 기반 정량 검증이 수행되었습니다.

카탈로그번호
HPA019576-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019576-100 Anti-SLC35F1 Antibody, solute carrier family 35, member F1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019576-25 Anti-SLC35F1 Antibody, solute carrier family 35, member F1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC35F1 Antibody

Anti-SLC35F1 Antibody

Target: solute carrier family 35, member F1 (SLC35F1)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human SLC35F1.


Alternative Gene Names

C6orf169, dJ230I3.1

Open Datasheet


Specifications

항목 내용
Target Protein solute carrier family 35, member F1
Target Gene SLC35F1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA
Verified Species Reactivity Human
Interspecies Identity Mouse (98%), Rat (95%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.