CacheBy
Atlas Antibodies Anti-SLC29A3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC29A3 Antibody

상품 한눈에 보기

Human SLC29A3 단백질을 인식하는 Rabbit Polyclonal IgG 항체. ENT3로도 알려진 nucleoside transporter 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. Human 대상 반응 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA057905-100 Anti-SLC29A3 Antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057905-25 Anti-SLC29A3 Antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC29A3 Antibody

Anti-SLC29A3 Antibody

Target: solute carrier family 29 (equilibrative nucleoside transporter), member 3
Supplier: Atlas Antibodies


면역세포화학(ICC)


Product Description

Polyclonal Antibody against Human SLC29A3.


Alternative Gene Names

ENT3, FLJ11160

Open Datasheet


Target Information

항목 내용
Target Protein Solute carrier family 29 (equilibrative nucleoside transporter), member 3
Target Gene SLC29A3
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020100 (64%), Rat ENSRNOG00000000568 (62%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

YARYYMRPVLAAHVFSGEEELPQDSLSAPSVASRFIDSHTPPLRPILKKT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.