CacheBy
Atlas Antibodies Anti-SLC29A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC29A2 Antibody

상품 한눈에 보기

Human SLC29A2 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, PrEST 항원을 이용해 Affinity purification된 고품질 시약입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA018168-100 Anti-SLC29A2 Antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018168-25 Anti-SLC29A2 Antibody, solute carrier family 29 (equilibrative nucleoside transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC29A2 Antibody

Anti-SLC29A2 Antibody

Target: solute carrier family 29 (equilibrative nucleoside transporter), member 2
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human SLC29A2

Alternative Gene Names

DER12, ENT2, HNP36

Open Datasheet

Target Information

항목 내용
Target Protein solute carrier family 29 (equilibrative nucleoside transporter), member 2
Target Gene SLC29A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse: 74% (ENSMUSG00000024891), Rat: 70% (ENSRNOG00000050201)

Antigen Sequence:
KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Application
Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.