CacheBy
Atlas Antibodies Anti-SLC28A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC28A2 Antibody

상품 한눈에 보기

Human SLC28A2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 정량에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, PrEST 항원으로 친화 정제된 고품질 항체입니다.

카탈로그번호
HPA046068-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046068-100 Anti-SLC28A2 Antibody, solute carrier family 28 (concentrative nucleoside transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046068-25 Anti-SLC28A2 Antibody, solute carrier family 28 (concentrative nucleoside transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC28A2 Antibody

Anti-SLC28A2 Antibody

Target: solute carrier family 28 (concentrative nucleoside transporter), member 2
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SLC28A2

Alternative Gene Names

CNT2, HCNT2, HsT17153, SPNT1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein solute carrier family 28 (concentrative nucleoside transporter), member 2
Target Gene SLC28A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028668 (51%), Mouse ENSMUSG00000027219 (51%)

Antigen Sequence:

MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHASLFKK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.