CacheBy
Atlas Antibodies Anti-SLC28A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC28A2 Antibody

상품 한눈에 보기

Human SLC28A2 단백질을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation을 통해 검증됨. Recombinant PrEST 항원을 사용한 affinity purification 방식. Human 반응성 확인됨. PBS/glycerol buffer에 sodium azide 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055623-100 Anti-SLC28A2 Antibody, solute carrier family 28 (concentrative nucleoside transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055623-25 Anti-SLC28A2 Antibody, solute carrier family 28 (concentrative nucleoside transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC28A2 Antibody

Anti-SLC28A2 Antibody

Solute carrier family 28 (concentrative nucleoside transporter), member 2

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SLC28A2.

Alternative Gene Names

CNT2, HCNT2, HsT17153, SPNT1

Open Datasheet

Target Information

항목 내용
Target Protein Solute carrier family 28 (concentrative nucleoside transporter), member 2
Target Gene SLC28A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000027219 (51%), Rat ENSRNOG00000028668 (51%)

Antigen Sequence:

MEKASGRQSIALSTVETGTVNLGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFCKTHASLFKK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.