CacheBy
Atlas Antibodies Anti-SIT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SIT1 Antibody

상품 한눈에 보기

Human SIT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원으로 정제되었으며, PBS/glycerol buffer에 보존. SIT1 단백질 발현 연구 및 신호전달 관련 연구용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018506-100 Anti-SIT1 Antibody, signaling threshold regulating transmembrane adaptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018506-25 Anti-SIT1 Antibody, signaling threshold regulating transmembrane adaptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SIT1 Antibody

Anti-SIT1 Antibody

Signaling threshold regulating transmembrane adaptor 1

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human SIT1

Alternative Gene Names

SIT

Open Datasheet

Target Information

항목 내용
Target Protein signaling threshold regulating transmembrane adaptor 1
Target Gene SIT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTR
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000021546 (78%), Mouse ENSMUSG00000028460 (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.