원본

Atlas Antibodies Anti-SIRT7 Antibody

상품 한눈에 보기

Human SIRT7 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% glycerol과 PBS 완충액에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053669-100 Anti-SIRT7 Antibody, sirtuin 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053669-25 Anti-SIRT7 Antibody, sirtuin 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: sirtuin 7
Target Gene: SIRT7
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE

Polyclonal antibody against Human SIRT7.

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage	Store at recommended temperature. Gently mix before use.
Notes	Optimal concentrations and conditions should be determined by the user.