CacheBy
Atlas Antibodies Anti-SIRT7 Antibody
원본

Atlas Antibodies Anti-SIRT7 Antibody

상품 한눈에 보기

Human SIRT7 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% glycerol과 PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053669-100 Anti-SIRT7 Antibody, sirtuin 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053669-25 Anti-SIRT7 Antibody, sirtuin 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SIRT7 Antibody

Anti-SIRT7 Antibody

Target Information

  • Target Protein: sirtuin 7
  • Target Gene: SIRT7
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LVVYTGAGISTAASIPDYRGPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPRTAISE
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human SIRT7.

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000025138 (99%)
  • Rat ENSRNOG00000036683 (95%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Store at recommended temperature. Gently mix before use.
Notes Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.