CacheBy
Atlas Antibodies Anti-EME2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EME2 Antibody

상품 한눈에 보기

Human EME2 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용해 정제됨. IHC 등 다양한 응용에 적합하며, 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 69% 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045770-100 Anti-EME2 Antibody, essential meiotic structure-specific endonuclease subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045770-25 Anti-EME2 Antibody, essential meiotic structure-specific endonuclease subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EME2 Antibody

Anti-EME2 Antibody

Essential meiotic structure-specific endonuclease subunit 2

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human EME2.

Alternative Gene Names

  • FLJ00151
  • SLX2B

Open Datasheet

Target Information

항목 내용
Target Protein Essential meiotic structure-specific endonuclease subunit 2
Target Gene EME2
Antigen Sequence ALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQFSRVS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000024867 (69%), Mouse ENSMUSG00000073436 (69%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.