
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EMC7 Antibody
상품 한눈에 보기
Human EMC7 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트에서 100% 동일한 항원 서열 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047572-100 Anti-EMC7 Antibody, ER membrane protein complex subunit 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047572-25 Anti-EMC7 Antibody, ER membrane protein complex subunit 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EMC7 Antibody
Anti-EMC7 Antibody
ER membrane protein complex subunit 7
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human EMC7
Alternative Gene Names
- C11orf3
- C15orf24
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ER membrane protein complex subunit 7 |
| Target Gene | EMC7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGK |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000055943) — 100%
- Rat (ENSRNOG00000005884) — 100%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



