CacheBy
Atlas Antibodies Anti-ELOVL7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELOVL7 Antibody

상품 한눈에 보기

인간 ELOVL7 단백질을 인식하는 토끼 다클론 항체로, WB 및 IHC에 추천됩니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 기반 PBS 버퍼에 보존됩니다. 인간 반응성이 검증되었으며, 마우스 및 랫트와 교차 반응성이 보고되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036337-100 Anti-ELOVL7 Antibody, ELOVL fatty acid elongase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036337-25 Anti-ELOVL7 Antibody, ELOVL fatty acid elongase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELOVL7 Antibody

Anti-ELOVL7 Antibody

Target: ELOVL fatty acid elongase 7
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ELOVL7.


Alternative Gene Names

  • FLJ23563

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ELOVL fatty acid elongase 7
Target Gene ELOVL7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MAFSDLTSRTVHLYDNWIKDADPRVEDWLLM

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000021696 90%
Rat ENSRNOG00000009773 48%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.