Atlas Antibodies Anti-ELOVL5 Antibody

상품 한눈에 보기

인간 ELOVL5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. RNA-seq 데이터 기반의 정교한 직교 검증을 거쳤으며, 고순도의 친화 정제 방식으로 제조되었습니다. 다양한 조직 및 세포주에서 ELOVL5 발현 연구에 활용 가능합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047752-100 Anti-ELOVL5 Antibody, ELOVL fatty acid elongase 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047752-25 Anti-ELOVL5 Antibody, ELOVL fatty acid elongase 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ELOVL5 Antibody

Anti-ELOVL5 Antibody

ELOVL fatty acid elongase 5

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human ELOVL5

Alternative Gene Names

dJ483K16.1, HELO1, SCA38

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	ELOVL fatty acid elongase 5
Target Gene	ELOVL5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	QTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000032349 (88%), Rat ENSRNOG00000006331 (79%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand