CacheBy
Atlas Antibodies Anti-DUSP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUSP3 Antibody

상품 한눈에 보기

Human DUSP3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. Human에 검증되었으며, ICC 등 다양한 응용에 적합. 40% glycerol 기반 PBS buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063616-100 Anti-DUSP3 Antibody, dual specificity phosphatase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063616-25 Anti-DUSP3 Antibody, dual specificity phosphatase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUSP3 Antibody

Anti-DUSP3 Antibody

Target: Dual Specificity Phosphatase 3 (DUSP3)
Type: Polyclonal Antibody against Human DUSP3
Supplier: Atlas Antibodies


면역세포화학(ICC) 등 다양한 연구 응용에 사용 가능.


Product Description

Polyclonal antibody against human DUSP3, also known as dual specificity phosphatase 3.


Alternative Gene Names

  • VHR

Target Information

항목 내용
Target Protein Dual specificity phosphatase 3
Target Gene DUSP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Mouse ENSMUSG00000003518 94%
Rat ENSRNOG00000036798 88%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 환경에 맞게 결정해야 합니다.

Additional Resources


제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.