원본

Atlas Antibodies Anti-DUSP28 Antibody

상품 한눈에 보기

인간 DUSP28 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제되었습니다. Human에 반응성이 검증되었으며, 고순도 PBS buffer에 보존 처리되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047456-100 Anti-DUSP28 Antibody, dual specificity phosphatase 28 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047456-25 Anti-DUSP28 Antibody, dual specificity phosphatase 28 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human DUSP28.

면역조직화학(IHC)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVAEPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Species Reactivity	Human
Applications	IHC (Immunohistochemistry)