CacheBy
Atlas Antibodies Anti-SERPINB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINB1 Antibody

상품 한눈에 보기

휴먼 SERPINB1 단백질을 인식하는 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 수행. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. 다양한 조직 및 세포주 단백질 발현 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA052642-100 Anti-SERPINB1 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052642-25 Anti-SERPINB1 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINB1 Antibody

Anti-SERPINB1 Antibody

Target: serpin peptidase inhibitor, clade B (ovalbumin), member 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human SERPINB1


Alternative Gene Names

anti-elastase, EI, ELANH2, PI2

Open Datasheet


Target Information

항목 내용
Target Protein serpin peptidase inhibitor, clade B (ovalbumin), member 1
Target Gene SERPINB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFK
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000044734 (79%), Rat ENSRNOG00000016581 (78%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.