CacheBy
Atlas Antibodies Anti-SERPINB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINB1 Antibody

상품 한눈에 보기

Human SERPINB1 단백질을 표적하는 고품질 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 Orthogonal Validation 수행. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. 인간 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA018871-100 Anti-SERPINB1 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018871-25 Anti-SERPINB1 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINB1 Antibody

Anti-SERPINB1 Antibody

Target: serpin peptidase inhibitor, clade B (ovalbumin), member 1
Type: Polyclonal Antibody against Human SERPINB1

  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Alternative Gene Names

anti-elastase, EI, ELANH2, PI2

Open Datasheet

Target Information

항목 내용
Target Protein serpin peptidase inhibitor, clade B (ovalbumin), member 1
Target Gene SERPINB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFK

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000044734 79%
Rat ENSRNOG00000016581 78%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.