CacheBy
Atlas Antibodies Anti-SERPINB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SERPINB1 Antibody

상품 한눈에 보기

Human SERPINB1 단백질을 표적하는 고품질 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 Orthogonal Validation 수행. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. 인간 반응성 검증 완료.

카탈로그번호
HPA018871-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018871-100 Anti-SERPINB1 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018871-25 Anti-SERPINB1 Antibody, serpin peptidase inhibitor, clade B (ovalbumin), member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SERPINB1 Antibody

Anti-SERPINB1 Antibody

Target: serpin peptidase inhibitor, clade B (ovalbumin), member 1
Type: Polyclonal Antibody against Human SERPINB1

  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Alternative Gene Names

anti-elastase, EI, ELANH2, PI2

Open Datasheet

Target Information

항목 내용
Target Protein serpin peptidase inhibitor, clade B (ovalbumin), member 1
Target Gene SERPINB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFK

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000044734 79%
Rat ENSRNOG00000016581 78%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.