CacheBy
Atlas Antibodies Anti-SCTR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCTR Antibody

상품 한눈에 보기

Human SCTR(Secretin Receptor)를 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유. 안정한 PBS/glycerol buffer로 보존.

카탈로그번호
HPA007269-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007269-100 Anti-SCTR Antibody, secretin receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007269-25 Anti-SCTR Antibody, secretin receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCTR Antibody

Anti-SCTR Antibody

Target Information

  • Target Protein: Secretin receptor
  • Target Gene: SCTR
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL

Product Description

Polyclonal antibody against human SCTR.

Open Datasheet (PDF)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000049766 (70%)
  • Mouse: ENSMUSG00000026387 (66%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Immunohistochemistry (IHC)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.