CacheBy
Atlas Antibodies Anti-SCT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCT Antibody

상품 한눈에 보기

Human SCT 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal Validation 완료. Recombinant PrEST 항원으로 정제되었으며, PBS와 glycerol buffer에 보존. RNA-seq 데이터 기반의 단백질 발현 검증에 적합.

카탈로그번호
HPA050961-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050961-100 Anti-SCT Antibody, secretin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050961-25 Anti-SCT Antibody, secretin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCT Antibody

Anti-SCT Antibody

Target Protein: secretin
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SCT.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein secretin
Target Gene SCT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTL

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000017873 (51%)
Mouse ENSMUSG00000038580 (51%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.