CacheBy
Atlas Antibodies Anti-SCN4A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCN4A Antibody

상품 한눈에 보기

인간 SCN4A 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생성된 IgG 형식으로, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증되었으며, 전압 개폐형 나트륨 채널 연구에 적합. 글리세롤 및 PBS 버퍼로 안정화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA053992-100 Anti-SCN4A Antibody, sodium channel, voltage-gated, type IV, alpha subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053992-25 Anti-SCN4A Antibody, sodium channel, voltage-gated, type IV, alpha subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCN4A Antibody

Anti-SCN4A Antibody

Target: Sodium channel, voltage-gated, type IV, alpha subunit
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SCN4A.


Alternative Gene Names

HYKPP, HYPP, Nav1.4, SkM1

Open Datasheet


Target Information

항목 내용
Target Protein Sodium channel, voltage-gated, type IV, alpha subunit
Target Gene SCN4A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012134 (67%), Mouse ENSMUSG00000001027 (65%)

Antigen Sequence:
MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.