CacheBy
Atlas Antibodies Anti-SCN3B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCN3B Antibody

상품 한눈에 보기

인간 SCN3B 단백질을 인식하는 토끼 폴리클로날 항체. 나트륨 전압 개폐 채널 베타 서브유닛 3 검출용. PrEST 항원을 이용한 친화 정제 방식. 인간 반응성 검증 완료. 면역세포화학(ICC) 등 다양한 응용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041707-100 Anti-SCN3B Antibody, sodium voltage-gated channel beta subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041707-25 Anti-SCN3B Antibody, sodium voltage-gated channel beta subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCN3B Antibody

Anti-SCN3B Antibody

Target Information

  • Target Protein: Sodium voltage-gated channel beta subunit 3
  • Target Gene: SCN3B
  • Alternative Gene Names: HSA243396

Product Description

Polyclonal antibody against human SCN3B, produced in rabbit.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000049281 (100%)
  • Rat ENSRNOG00000057221 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.