Atlas Antibodies Anti-DPEP3 Antibody

상품 한눈에 보기

인간 DPEP3 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증. PrEST 항원을 이용한 친화 정제. 40% 글리세롤 기반 PBS 완충액에 보존제 포함. 다양한 연구 응용에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058607-100 Anti-DPEP3 Antibody, dipeptidase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058607-25 Anti-DPEP3 Antibody, dipeptidase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: dipeptidase 3
Recommended Applications: IHC (Orthogonal validation)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human DPEP3.

항목	내용
Target Protein	dipeptidase 3
Target Gene	DPEP3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPL
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000023303 (43%), Mouse ENSMUSG00000053687 (42%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
MSDS	Material Safety Data Sheet