CacheBy
Atlas Antibodies Anti-DPEP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DPEP3 Antibody

상품 한눈에 보기

인간 DPEP3 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 RNA-seq 비교를 통한 오쏘고날 검증 완료. 토끼 유래 IgG 형식으로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. PBS 및 글리세롤 버퍼에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031870-100 Anti-DPEP3 Antibody, dipeptidase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031870-25 Anti-DPEP3 Antibody, dipeptidase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DPEP3 Antibody

Anti-DPEP3 Antibody

Target Protein: dipeptidase 3
Target Gene: DPEP3

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human DPEP3.

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPL

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000023303 43%
Mouse ENSMUSG00000053687 42%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.