
원본
Atlas Antibodies Anti-DLK1 Antibody
상품 한눈에 보기
Human DLK1 단백질을 인식하는 rabbit polyclonal 항체로, WB 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 반응성이 검증되었습니다. 40% glycerol 및 PBS buffer로 안정화되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053879-100 Anti-DLK1 Antibody, delta-like 1 homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053879-25 Anti-DLK1 Antibody, delta-like 1 homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DLK1 Antibody
Anti-DLK1 Antibody
Target: delta-like 1 homolog (Drosophila)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
Product Description
Polyclonal antibody against Human DLK1.
Alternative Gene Names
Delta1, FA1, pG2, Pref-1, ZOG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | delta-like 1 homolog (Drosophila) |
| Target Gene | DLK1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000098411 (96%), Rat ENSRNOG00000019584 (94%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



