CacheBy
Atlas Antibodies Anti-DLK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DLK2 Antibody

상품 한눈에 보기

Human DLK2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. EGFL9로도 알려진 DLK2 타깃. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공. PBS와 글리세롤 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068672-100 Anti-DLK2 Antibody, delta-like 2 homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068672-25 Anti-DLK2 Antibody, delta-like 2 homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DLK2 Antibody

Anti-DLK2 Antibody

Target: delta-like 2 homolog (Drosophila)
Product Type: Polyclonal Antibody against Human DLK2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against Human DLK2 (delta-like 2 homolog, Drosophila).


Alternative Gene Names

  • EGFL9
  • MGC2487

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein delta-like 2 homolog (Drosophila)
Target Gene DLK2
Alternative Gene Names EGFL9, MGC2487
Verified Species Reactivity Human
Ortholog Identity Mouse (91%), Rat (89%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:

RNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSC

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer and Storage

항목 내용
Buffer Composition 40% glycerol, PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.