CacheBy
Atlas Antibodies Anti-DLGAP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DLGAP3 Antibody

상품 한눈에 보기

Human DLGAP3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증됨. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027304-100 Anti-DLGAP3 Antibody, DLG associated protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027304-25 Anti-DLGAP3 Antibody, DLG associated protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DLGAP3 Antibody

Anti-DLGAP3 Antibody

Target: discs, large (Drosophila) homolog-associated protein 3
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human DLGAP3


Alternative Gene Names

DAP3, SAPAP3

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein discs, large (Drosophila) homolog-associated protein 3
Target Gene DLGAP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DSDSGFLAGGRPPGEPGGPFCLEGPDGSYRDLSFKGRSGGSEGRCLACTGMSMSLDGQSVKRSAWHTMMVSQGRDGYPGAGPGKGLLGPETKAKARTYHYLQVPQ
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014302 (97%), Mouse ENSMUSG00000042388 (97%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Safety Information Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.