CacheBy
Atlas Antibodies Anti-DLG4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DLG4 Antibody

상품 한눈에 보기

인간 DLG4 단백질을 인식하는 토끼 폴리클로날 항체로, PSD-95/SAP90 등과 관련된 신경 시냅스 단백질 연구에 적합함. IHC 정량 검증을 통해 RNA-seq 데이터와 비교된 정밀한 발현 분석 가능. 고순도 친화 정제 및 안정적 보존용액 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010122-100 Anti-DLG4 Antibody, discs, large homolog 4 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010122-25 Anti-DLG4 Antibody, discs, large homolog 4 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DLG4 Antibody

Anti-DLG4 Antibody

Target: discs, large homolog 4 (Drosophila)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human DLG4


Alternative Gene Names

PSD-95, PSD95, SAP-90, SAP90

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein discs, large homolog 4 (Drosophila)
Target Gene DLG4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020886 (99%), Rat ENSRNOG00000018526 (99%)

Antigen Sequence:

HDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYAR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.