CacheBy
Atlas Antibodies Anti-DKK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DKK3 Antibody

상품 한눈에 보기

인간 DKK3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증 완료된 고품질 항체이며, 토끼 유래 IgG 형식으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011868-100 Anti-DKK3 Antibody, dickkopf WNT signaling pathway inhibitor 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011868-25 Anti-DKK3 Antibody, dickkopf WNT signaling pathway inhibitor 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DKK3 Antibody

Anti-DKK3 Antibody

Target: dickkopf WNT signaling pathway inhibitor 3 (DKK3)
Type: Polyclonal Antibody against Human DKK3
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    • Recombinant expression validation in WB using target protein overexpression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting human DKK3.

Alternative Gene Names: REIC, RIG
Datasheet: Open Datasheet (PDF)


Target Information

항목 내용
Target Protein dickkopf WNT signaling pathway inhibitor 3
Target Gene DKK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (83%), Rat (81%)

Antigen Sequence:

CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet: MSDS - Sodium Azide


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.