CacheBy
Atlas Antibodies Anti-DKC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DKC1 Antibody

상품 한눈에 보기

Human DKC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 WB에 적합합니다. Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다. Dyskeratosis congenita 연구 및 DKC1 단백질 발현 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001022-100 Anti-DKC1 Antibody, dyskeratosis congenita 1, dyskerin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001022-25 Anti-DKC1 Antibody, dyskeratosis congenita 1, dyskerin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DKC1 Antibody

Anti-DKC1 Antibody

Target: dyskeratosis congenita 1, dyskerin
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human DKC1.


Alternative Gene Names

DKC, dyskerin, NAP57, NOLA4, XAP101

Open Datasheet


Target Information

항목 내용
Target Protein dyskeratosis congenita 1, dyskerin
Target Gene DKC1
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031403 (99%), Rat ENSRNOG00000055562 (92%)

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.