Atlas Antibodies Anti-DIABLO Antibody

상품 한눈에 보기

Human DIABLO 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001825-100 Anti-DIABLO Antibody, diablo, IAP-binding mitochondrial protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001825-25 Anti-DIABLO Antibody, diablo, IAP-binding mitochondrial protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: diablo, IAP-binding mitochondrial protein
Supplier: Atlas Antibodies

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Polyclonal antibody against Human DIABLO.

DFNA64, DIABLO-S, FLJ10537, FLJ25049, SMAC

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000029197	88%
Mouse	ENSMUSG00000029433	88%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand