CacheBy
Atlas Antibodies Anti-DHX58 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHX58 Antibody

상품 한눈에 보기

인간 DHX58 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 보입니다. 40% 글리세롤/PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018670-100 Anti-DHX58 Antibody, DEXH (Asp-Glu-X-His) box polypeptide 58 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018670-25 Anti-DHX58 Antibody, DEXH (Asp-Glu-X-His) box polypeptide 58 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHX58 Antibody

Anti-DHX58 Antibody

DEXH (Asp-Glu-X-His) box polypeptide 58

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human DHX58.

Alternative Gene Names

  • D11LGP2
  • LGP2

Open Datasheet

Target Information

항목 내용
Target Protein DEXH (Asp-Glu-X-His) box polypeptide 58
Target Gene DHX58
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000018247 (76%), Mouse ENSMUSG00000017830 (71%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.