AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DHX30 Antibody
상품 한눈에 보기
인간 DHX30 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다. 인간, 생쥐, 랫드에 반응합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034806-100 Anti-DHX30 Antibody, DEAH (Asp-Glu-Ala-His) box helicase 30 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034806-25 Anti-DHX30 Antibody, DEAH (Asp-Glu-Ala-His) box helicase 30 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DHX30 Antibody
Anti-DHX30 Antibody
Target: DEAH (Asp-Glu-Ala-His) box helicase 30
Type: Polyclonal Antibody against Human DHX30
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human DHX30 protein.
Alternative Gene Names
DDX30, FLJ11214, KIAA0890
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DEAH (Asp-Glu-Ala-His) box helicase 30 |
| Target Gene | DHX30 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to:
- Rat (ENSRNOG00000029194) – 100%
- Mouse (ENSMUSG00000032480) – 100%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.