CacheBy
Atlas Antibodies Anti-DHX29 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHX29 Antibody

상품 한눈에 보기

Human DHX29 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. DDX29 유전자 연구 및 단백질 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038318-100 Anti-DHX29 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 29 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038318-25 Anti-DHX29 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 29 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHX29 Antibody

Anti-DHX29 Antibody

DEAH (Asp-Glu-Ala-His) box polypeptide 29

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human DHX29.

Alternative Gene Names

  • DDX29

Open Datasheet

Target Information

항목 내용
Target Protein DEAH (Asp-Glu-Ala-His) box polypeptide 29
Target Gene DHX29
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Antigen Sequence Identity
Rat ENSRNOG00000010369 95%
Mouse ENSMUSG00000042426 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.