AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DHRS2 Antibody
상품 한눈에 보기
인간 DHRS2 단백질에 특이적인 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, 40% 글리세롤 PBS 버퍼에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA069551-100 Anti-DHRS2 Antibody, dehydrogenase/reductase (SDR family) member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069551-25 Anti-DHRS2 Antibody, dehydrogenase/reductase (SDR family) member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DHRS2 Antibody
Anti-DHRS2 Antibody
Target Information
- Target Protein: dehydrogenase/reductase (SDR family) member 2
- Target Gene: DHRS2
- Alternative Gene Names: HEP27, SDR25C1
Product Description
Polyclonal antibody against human DHRS2.
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000018177): 80%
- Mouse (ENSMUSG00000022209): 80%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.