CacheBy
Atlas Antibodies Anti-DHRS11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHRS11 Antibody

상품 한눈에 보기

Human DHRS11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합. RNA-seq 데이터와의 정합을 통한 정교한 Orthogonal validation 수행. 고순도의 Affinity 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048236-100 Anti-DHRS11 Antibody, dehydrogenase/reductase (SDR family) member 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048236-25 Anti-DHRS11 Antibody, dehydrogenase/reductase (SDR family) member 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHRS11 Antibody

Anti-DHRS11 Antibody

Target: dehydrogenase/reductase (SDR family) member 11
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation:
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human DHRS11 (dehydrogenase/reductase [SDR family] member 11).


Alternative Gene Names

  • MGC4172
  • SDR24C1

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    LARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000034449 92%
Rat ENSRNOG00000027891 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.