CacheBy
Atlas Antibodies Anti-DEK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DEK Antibody

상품 한눈에 보기

Human DEK 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 완료. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 Affinity 정제됨. Human 반응성 확인, 연구용으로 적합.

카탈로그번호
HPA057799-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057799-100 Anti-DEK Antibody, DEK proto-oncogene 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057799-25 Anti-DEK Antibody, DEK proto-oncogene 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DEK Antibody

Anti-DEK Antibody

Target Information

  • Target Protein: DEK proto-oncogene
  • Target Gene: DEK
  • Alternative Gene Names: D6S231E

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human DEK

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
SEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTER

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000021377 93%
Rat ENSRNOG00000016152 93%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.