Atlas Antibodies Anti-DEK Antibody

상품 한눈에 보기

Human DEK 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 포함한 단백질 발현 분석에 적합합니다. Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 높은 신뢰성을 제공합니다. PrEST 항원을 이용해 친화 정제되었으며, 휴먼 반응성이 검증되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054505-100 Anti-DEK Antibody, DEK proto-oncogene 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054505-25 Anti-DEK Antibody, DEK proto-oncogene 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DEK Antibody

Anti-DEK Antibody

Target: DEK proto-oncogene
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human DEK.

Alternative Gene Names

D6S231E

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	DEK proto-oncogene
Target Gene	DEK
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	SEDSSDDEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTER

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016152 (93%)
Mouse ENSMUSG00000021377 (93%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method	Affinity purified using the PrEST antigen as affinity ligand