CacheBy
Atlas Antibodies Anti-DEFA5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DEFA5 Antibody

상품 한눈에 보기

Human DEFA5 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. Affinity purification 방식으로 정제되었으며, ICC 등 다양한 응용에 적합합니다. 40% glycerol, PBS buffer 및 sodium azide 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015309-100 Anti-DEFA5 Antibody, defensin alpha 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015309-25 Anti-DEFA5 Antibody, defensin alpha 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DEFA5 Antibody

Anti-DEFA5 Antibody

Target Protein: defensin alpha 5
Target Gene: DEFA5
Alternative Gene Names: DEF5, HD-5

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DEFA5.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000030093 (49%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.