CacheBy
Atlas Antibodies Anti-DEFA4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DEFA4 Antibody

상품 한눈에 보기

Human DEFA4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. DEF4, HP-4 대체 유전자명으로도 알려져 있으며, PrEST 항원으로 정제되었습니다. 인체 시료에 대한 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051266-100 Anti-DEFA4 Antibody, defensin, alpha 4, corticostatin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051266-25 Anti-DEFA4 Antibody, defensin, alpha 4, corticostatin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DEFA4 Antibody

Anti-DEFA4 Antibody

defensin, alpha 4, corticostatin


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human DEFA4.


Alternative Gene Names

DEF4, HP-4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein defensin, alpha 4, corticostatin
Target Gene DEFA4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000028707 (36%), Mouse ENSMUSG00000074446 (32%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.