CacheBy
Atlas Antibodies Anti-DDX4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDX4 Antibody

상품 한눈에 보기

인간 DDX4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석에 적합합니다. RNA-seq 데이터 기반 직교 검증 완료. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤/PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037763-100 Anti-DDX4 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037763-25 Anti-DDX4 Antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDX4 Antibody

Anti-DDX4 Antibody

DEAD (Asp-Glu-Ala-Asp) box polypeptide 4


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human DDX4


Alternative Gene Names

  • VASA

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein DEAD (Asp-Glu-Ala-Asp) box polypeptide 4
Target Gene DDX4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000021758 85%
Rat ENSRNOG00000026686 63%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.